DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Limk1

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_036020724.1 Gene:Limk1 / 16885 MGIID:104572 Length:702 Species:Mus musculus


Alignment Length:133 Identity:44/133 - (33%)
Similarity:68/133 - (51%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 CSGRTE-VGHIKCEKNFEL--CEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHHTCYVRNS 318
            |:.|.| :|    |:..||  |..|||:|:|...:...:|:||..|..||.|.:.|.|..|.::.
Mouse     8 CTWREERMG----EEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSVSLSHQYYEKDG 68

  Fly   319 KLYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQF-MLRDGQ 382
            :|:||.||...:|..|..|...| .:.||| ......:|..||:|.||...:..|:.: ::...:
Mouse    69 QLFCKKDYWARYGESCHGCSEHI-TKGLVM-VAGELKYHPECFICLACGNFIGDGDTYTLVEHSK 131

  Fly   383 LFC 385
            |:|
Mouse   132 LYC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 20/51 (39%)
LIM 333..388 CDD:295319 15/54 (28%)
Homeobox 427..480 CDD:278475
Limk1XP_036020724.1 LIM1_LIMK1 5..77 CDD:188846 27/72 (38%)
LIM2_LIMK1 84..138 CDD:188848 15/53 (28%)
PDZ 165..255 CDD:395476
STKc_LIMK1 345..666 CDD:271123
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.