DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Lhx8

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_034843.2 Gene:Lhx8 / 16875 MGIID:1096343 Length:367 Species:Mus musculus


Alignment Length:285 Identity:93/285 - (32%)
Similarity:144/285 - (50%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 PAATGSGNANGSGNGNGNGNGNGNGNGNGNGGGAATASAAAASKLSADCSGRTEVGHIKCEKNFE 273
            |||..:|.........|..|..|.|:.:         |.::::.||...|.::......|.....
Mouse    39 PAALAAGRTRKGAGEEGLVNPEGAGDED---------SCSSSAPLSPSSSPQSMASGSVCPPGKC 94

  Fly   274 LCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQL--HHTCYVRNSKLYCKMDYDRLFGVKCSS 336
            :|..||.:|.|::|:.|.|..||.:||:|..|...|  |.:||:::..::||:||.|.:|.:||.
Mouse    95 VCSSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSR 159

  Fly   337 CCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRH------DLEKEM- 394
            |...|...:.|.|...| |:||.||.|::|:..|..||:|.|.:.::.|..|      :|::|: 
Mouse   160 CGRHIHSTDWVRRAKGN-VYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHFDCMLDNLKREVE 223

  Fly   395 ---FLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREA 456
               .::...|.      |.|:|:..|:..    ||.||..|:.|.:..:|.|.|...|..:..:.
Mouse   224 NGNGISVEGAL------LTEQDVNHPKPA----KRARTSFTADQLQVMQAQFAQDNNPDAQTLQK 278

  Fly   457 LAKDTGLSVRVVQVWFQNQRAKMKK 481
            ||:.||||.||:||||||.||:.||
Mouse   279 LAERTGLSRRVIQVWFQNCRARHKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 21/53 (40%)
LIM 333..388 CDD:295319 20/54 (37%)
Homeobox 427..480 CDD:278475 24/52 (46%)
Lhx8NP_034843.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..79 8/43 (19%)
LIM1_Lhx7_Lhx8 95..150 CDD:188767 21/54 (39%)
LIM2_Lhx7_Lhx8 157..211 CDD:188769 20/54 (37%)
Homeobox 250..302 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.