DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and PRICKLE2

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_011531734.1 Gene:PRICKLE2 / 166336 HGNCID:20340 Length:966 Species:Homo sapiens


Alignment Length:256 Identity:58/256 - (22%)
Similarity:91/256 - (35%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 GRTEVGHIKCEKNFELCEGCGQKIHDRFLMNVGD-----------ANWHEQCLACCYCGMQLHHT 312
            ||..|..........:||.||.:|      |.||           ..||..|..|..|...|...
Human   206 GRGNVRPFPVTMTGAICEQCGGQI------NGGDIAVFASRAGHGVCWHPPCFVCTVCNELLVDL 264

  Fly   313 CY-VRNSKLYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQF 376
            .| .::.|:||...:......:|::|...|...|..  ......:|:..|.|:.|...| .|:::
Human   265 IYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECT--EAEGRHWHMKHFCCFECETVL-GGQRY 326

  Fly   377 MLRDGQLFCYRHDLEKEMFLAA----AAAQHCGFVGLDEEDLLRPRDGRRGPKRPRTILTSQQRK 437
            ::::|:.:|. |..|.   |.|    ..|||   :|:|:..:  ..||:...........:..:|
Human   327 IMKEGRPYCC-HCFES---LYAEYCDTCAQH---IGIDQGQM--TYDGQHWHATETCFCCAHCKK 382

  Fly   438 QF-------KASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGG 491
            ..       |.......:.|....:....|:..|.      |||.|||..:...|..:|.|
Human   383 SLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSA------FQNARAKESRRSAKIGKNKG 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 18/63 (29%)
LIM 333..388 CDD:295319 12/54 (22%)
Homeobox 427..480 CDD:278475 11/59 (19%)
PRICKLE2XP_011531734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.