DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and AgaP_AGAP005400

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_315409.2 Gene:AgaP_AGAP005400 / 1276101 VectorBaseID:AGAP005400 Length:353 Species:Anopheles gambiae


Alignment Length:184 Identity:42/184 - (22%)
Similarity:68/184 - (36%) Gaps:52/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 CEGCGQKIHDRFLMNVG-------DANWHEQCLACCYCGMQLHHTCYV-RNSKLYCKMDYDRLFG 331
            |:|||:      :...|       ...|||:|..||.|...:....:: |..::||...|:..:.
Mosquito   173 CDGCGE------IFRAGTKKMEYKTRQWHEKCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKYA 231

  Fly   332 VKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRD---------GQLFCYR 387
            .:|..|...|....:..:..|   :|..||.|..|::.| .|::|..||         |:||..|
Mosquito   232 TRCIKCKKIITSGGVTYKNEP---WHRECFTCTHCQVSL-AGQRFTSRDEKPYCAECFGELFAKR 292

  Fly   388 ---------------------HDLEKEMFLAAAAAQHC---GFVGLDEEDLLRP 417
                                 .....:.|:.|......   ||: .||:|::.|
Mosquito   293 CTSCTKPITGIGGTRFISFEDRHWHNDCFICAMCKTSLVGRGFI-TDEQDVICP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 15/59 (25%)
LIM 333..388 CDD:295319 18/84 (21%)
Homeobox 427..480 CDD:278475
AgaP_AGAP005400XP_315409.2 LIM 51..105 CDD:295319
LIM3_LIMPETin 108..166 CDD:188805
LIM4_LIMPETin 173..226 CDD:188809 15/58 (26%)
LIM5_LIMPETin 234..285 CDD:188814 14/54 (26%)
LIM6_LIMPETin 293..348 CDD:188816 8/54 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.