DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and DMBX1

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001374705.1 Gene:DMBX1 / 127343 HGNCID:19026 Length:382 Species:Homo sapiens


Alignment Length:241 Identity:65/241 - (26%)
Similarity:90/241 - (37%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 AAAAAQH-------------------CGFVGLDEEDLLRPRDG--RRGPKRPRTILTSQQRKQFK 440
            ||..|||                   |.|    ::.:|..|.|  .|..:|.||..|:||.:..:
Human    27 AAQQAQHAPDYRPSVHALTLAERLAGCTF----QDIILEARYGSQHRKQRRSRTAFTAQQLEALE 87

  Fly   441 ASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQR--------KAKQNGGSGG--- 494
            .:|.::..|...:||.||..|.|....|||||:|:|||.:|.||        |.|:..||.|   
Human    88 KTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKEAEGSHGEGK 152

  Fly   495 -------------------GSG---------SGRGTGNSSATDDKDTND-----KEDKCVKQELG 526
                               ||.         |.:....|:..|..|..:     .||...::..|
Human   153 AEAPTPDTQLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQPDREEDPRAGAEDPKAEKSPG 217

  Fly   527 GDSSGYLGGLDSTFASQPLNPNL-PFSPDDYPANSNDSFCSSDLSL 571
            .||.|......|..|..|.:..: |.:|.......:.|:.||.|||
Human   218 ADSKGLGCKRGSPKADSPGSLTITPVAPGGGLLGPSHSYSSSPLSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 22/52 (42%)
DMBX1NP_001374705.1 Interaction with OTX2 and is required for repressor activity. /evidence=ECO:0000250|UniProtKB:Q91ZK4 1..156 42/132 (32%)
Homeobox 74..128 CDD:395001 22/53 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..252 25/123 (20%)
OAR 357..373 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 359..372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.