DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and AgaP_AGAP012744

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_024667070.1 Gene:AgaP_AGAP012744 / 1268798 VectorBaseID:AGAP012744 Length:240 Species:Anopheles gambiae


Alignment Length:156 Identity:42/156 - (26%)
Similarity:68/156 - (43%) Gaps:22/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KCEKNFELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHH-TCYVRNSKLYCKMDYDRLF 330
            :|::.||        .|:| ::|.....||.||..|..|..|... ..|....:.||:.|:..||
Mosquito    21 RCDEGFE--------PHER-IVNSNGQLWHTQCFVCAQCFRQFQDGIFYEFEGRKYCEKDFHILF 76

  Fly   331 GVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRHDL---EK 392
            ...|:.|.:.::.: ::.....|  :|..||.|..|.:||  .:...:|:.:..|  ||.   ||
Mosquito    77 APCCAKCNNFVIGR-VIKAMAAN--WHPQCFTCERCSIPL--ADSGFIRNQKPLC--HDCNRKEK 134

  Fly   393 EMFLAAAAAQHCGFVGLDEEDLLRPR 418
            |:.|.......|.  |:.::..||.|
Mosquito   135 EVGLGKLVCNKCH--GIIDDAPLRFR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 14/52 (27%)
LIM 333..388 CDD:295319 12/54 (22%)
Homeobox 427..480 CDD:278475
AgaP_AGAP012744XP_024667070.1 LIM1_PINCH 19..77 CDD:188717 18/64 (28%)
LIM 80..130 CDD:295319 14/56 (25%)
LIM3_PINCH 143..203 CDD:188719 5/18 (28%)
LIM 209..>240 CDD:295319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.