DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and ATHB54

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001322131.1 Gene:ATHB54 / 10723019 AraportID:AT1G27045 Length:252 Species:Arabidopsis thaliana


Alignment Length:228 Identity:50/228 - (21%)
Similarity:87/228 - (38%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 AQHCGFVG-----------LDEEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPK--PCRK 452
            :.|..|.|           :||||:......|...|:.:  ||..|.:..:.||::..:  |.||
plant    33 SSHSAFYGSSSMINTETATMDEEDVCESYMMREITKKRK--LTPIQLRLLEESFEEEKRLEPDRK 95

  Fly   453 VREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKE 517
            :  .||:..||....|.|||||:||:.|..|.:              ....:..|:..|...|.:
plant    96 L--WLAEKLGLQPSQVAVWFQNRRARYKTKQLE--------------HDCDSLKASYAKLKTDWD 144

  Fly   518 DKCVKQELGGDSSGYLGGLDSTFASQPLNPNLPFSPDDYPANSNDSFCSSDL---------SLDG 573
            ...|:.:.......:|..|.|.:..:.:.            |.:|:|...||         :|:.
plant   145 ILFVQNQTLKSKVQFLNRLTSHYFQESVQ------------NFDDTFKQVDLLKEKLKMQENLET 197

  Fly   574 SNFD--QLDDDADSLSLNNLELQSTSSSGNQHS 604
            .:.:  :|.::..|:..:|.:........||:|
plant   198 QSIERKRLGEEGSSVKSDNTQYSEEEGLENQYS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 20/54 (37%)
ATHB54NP_001322131.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.