DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lmx1a and HOXB13

DIOPT Version :9

Sequence 1:	NP_729801.1	Gene:	Lmx1a / 39406	FlyBaseID:	FBgn0052105	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_006352.2	Gene:	HOXB13 / 10481	HGNCID:	5112	Length:	284	Species:	Homo sapiens

Alignment Length:	133	Identity:	35/133 - (26%)
Similarity:	54/133 - (40%)	Gaps:	26/133 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   368 LPLQKGEQFMLRDG---QLFCYRHDLEKEMFLAAAAA----QH----CGFVGLDEEDLLRPRDGR 421
            ||:...:.:.|..|   |:.|.........|..||.|    ||    |.|              |
Human   164 LPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAF--------------R 214

  Fly   422 RGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKA 486
            ||.|: |...:..|.::.:..:..:....:..|..::..|.||.|.:.:||||:|.|.||:..|.
Human   215 RGRKK-RIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKV 278

  Fly   487 KQN 489
            |.:
Human   279 KNS 281

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lmx1a	NP_729801.1	LIM1_Lmx1b	275..327	CDD:188757
		LIM	333..388	CDD:295319	6/22 (27%)
		Homeobox	427..480	CDD:278475	13/52 (25%)
HOXB13	NP_006352.2	HoxA13_N	12..121	CDD:372013
		HOX	216..272	CDD:197696	15/56 (27%)
		Interaction with DNA. /evidence=ECO:0000305\|PubMed:28473536, ECO:0000305\|Ref.8	217..246		3/29 (10%)
		Interaction with 5-mCpG DNA. /evidence=ECO:0000305\|PubMed:28473536	258..269		5/10 (50%)
		Interaction with DNA. /evidence=ECO:0000305\|PubMed:28473536, ECO:0000305\|Ref.8	270..273		1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910