powered by:
Protein Alignment Lmx1a and prop1
DIOPT Version :9
Sequence 1: | NP_729801.1 |
Gene: | Lmx1a / 39406 |
FlyBaseID: | FBgn0052105 |
Length: | 640 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004914810.1 |
Gene: | prop1 / 101734397 |
XenbaseID: | XB-GENE-22068967 |
Length: | 242 |
Species: | Xenopus tropicalis |
Alignment Length: | 65 |
Identity: | 24/65 - (36%) |
Similarity: | 40/65 - (61%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 425 KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQN 489
:|.||..:.:|.:..:.:|.::..|....||.|||.|.|:...:||||||:|||.:|.:|..:::
Frog 67 RRHRTTFSQEQLEHLETAFSKNHYPDIYCREELAKITKLNEARIQVWFQNRRAKHRKHERTTQKS 131
Fly 490 489
Frog 132 131
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.