DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and hoxa7

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001363856.1 Gene:hoxa7 / 101734257 XenbaseID:XB-GENE-483655 Length:207 Species:Xenopus tropicalis


Alignment Length:137 Identity:39/137 - (28%)
Similarity:57/137 - (41%) Gaps:14/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 LFCYRHD-----LEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGP--KRPRTILTSQQRKQFK 440
            |.|...|     |..|:..|..||.|   ...|....:.|.....||  ||.|...|..|..:.:
 Frog    76 LHCSSFDQNIPLLCNELPKAEEAALH---QQADSHFRIYPWMRSSGPDRKRGRQTYTRYQTLELE 137

  Fly   441 ASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNS 505
            ..|..:....|:.|..:|....|:.|.:::||||:|.|.||   :.|:..|....:|.. .|..:
 Frog   138 KEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK---EHKEESGQTPDAGED-STAPT 198

  Fly   506 SATDDKD 512
            :..:|||
 Frog   199 TTAEDKD 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 2/4 (50%)
Homeobox 427..480 CDD:278475 15/52 (29%)
hoxa7NP_001363856.1 Homeobox 125..178 CDD:365835 15/52 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.