DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and hoxd13

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002935723.1 Gene:hoxd13 / 100498102 XenbaseID:XB-GENE-482320 Length:300 Species:Xenopus tropicalis


Alignment Length:383 Identity:79/383 - (20%)
Similarity:126/383 - (32%) Gaps:140/383 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 GGSSSNNLHSACNTLTAAAVAAASAA------AVAAPSPAGTSVATSQLGGAVAAAIAAAAAAAA 199
            ||....:.:...|.|::.:|..:.::      |.:||..:|:               |.|.|...
 Frog    18 GGGEGPSSNQCRNFLSSPSVFGSPSSRTVPGLAYSAPDRSGS---------------ARAEATKE 67

  Fly   200 AATTPTSTGPAATGSGNANGSGNGNGNG-------NGNG------NGNGNGNGGG------AATA 245
            ..|.|.||||    ||.:.|.|...|||       :|.|      ..:.:.:.||      ...:
 Frog    68 GPTCPASTGP----SGPSLGYGYHFGNGYYSCRMSHGVGLQQNPLKSSSHASLGGFPVEKYMDVS 128

  Fly   246 SAAAASKLSADCSGRT-EVGHIKCEKN-FELCEG---------CGQKIHDRFLMNVGDANWHEQC 299
            ..|:.|..|.:.|.|. ||.:.:...| ::...|         .|:..|:.::...|..:|   .
 Frog   129 GLASTSVPSNEVSSRAKEVSYFQGYTNPYQHVPGYLDMVSTFSSGEPRHEAYISMEGYQSW---T 190

  Fly   300 LACCYCGMQLHHTCYVRNSKLYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCY 364
            ||..:            |.::||..|..:                      .|:|         :
 Frog   191 LANGW------------NGQVYCPKDQSQ----------------------APHF---------W 212

  Fly   365 ACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRT 429
            ....|                                   |.|.|::.|:...|.||    :.|.
 Frog   213 KSSFP-----------------------------------GDVALNQADMCVYRRGR----KKRV 238

  Fly   430 ILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAK 487
            ..|..|.|:.:..:..:....:..|..::..|.||.|.|.:||||:|.|.|||..|.|
 Frog   239 PYTKLQLKELENEYAVNKFINKDKRRRISAATNLSERQVTIWFQNRRVKDKKIVSKLK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 11/60 (18%)
LIM 333..388 CDD:295319 3/54 (6%)
Homeobox 427..480 CDD:278475 16/52 (31%)
hoxd13XP_002935723.1 HoxA13_N 11..129 CDD:372013 29/129 (22%)
Homeobox 236..290 CDD:365835 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.