DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and tmem143

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_031762409.1 Gene:tmem143 / 100496619 XenbaseID:XB-GENE-6044161 Length:507 Species:Xenopus tropicalis


Alignment Length:248 Identity:49/248 - (19%)
Similarity:82/248 - (33%) Gaps:56/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 LDEEDLLRPRDGRRGPKRPRTILTSQQRKQF-----KASFDQSPKPCRKVREALAKDTGLS---V 465
            |..:....|::......:.|..:|...:.:|     |....|.|...|: |...|....:|   :
 Frog    19 LQTQSFFSPQENSCQSGKVRACVTDSLKLRFLSFQPKGRHSQWPAGARR-RYCAAAGLNVSPAPI 82

  Fly   466 RVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSA-----------TDDKD-TNDKED 518
            .|:.:.|......:..::.      .||.|..:.||.|..:|           .:.|| |...::
 Frog    83 EVIALSFIMLYTTLGAVRI------ASGIGIPAARGMGTLAAKMAEYRKMWKPIEPKDWTVQYQE 141

  Fly   519 KCVK-----------QELGGDSS---GYLGGLDSTFAS--QPLNPNL--------PFSPDDYPAN 559
            :.:.           ||:..|.|   .:|..:|....|  ||.:..|        |.:||.....
 Frog   142 RYIPLSKGQIVEHLIQEIHCDKSERQSFLSFVDQLEHSLFQPYHSTLEALQLLYDPINPDRDATL 206

  Fly   560 SNDSFCSSDLSLDGSNFDQLDDDADSLSLNNLELQSTSSSGNQHSHSHSNPHD 612
            ......|..|..:....|||....|..:.|.|...:.:.:...|     :|||
 Frog   207 ETPLLDSEKLLKEKEVLDQLQPVLDQANFNVLSEDALAYALIVH-----HPHD 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 12/60 (20%)
tmem143XP_031762409.1 DUF3754 298..422 CDD:403691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.