DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and ventx2.2

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002937178.3 Gene:ventx2.2 / 100494704 XenbaseID:XB-GENE-920515 Length:333 Species:Xenopus tropicalis


Alignment Length:72 Identity:24/72 - (33%)
Similarity:33/72 - (45%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 LRPRD-----GRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQN 474
            |.|.|     |:.| :|.||..||.|....:.:|.:........|..||....||...::.||||
 Frog   176 LSPNDTSDEEGKLG-RRLRTAFTSDQISTLEKTFQKHRYLGASERRKLAAKLQLSEVQIKTWFQN 239

  Fly   475 QRAKMKK 481
            :|.|.|:
 Frog   240 RRMKYKR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 17/52 (33%)
ventx2.2XP_002937178.3 Homeobox 193..246 CDD:395001 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.