Sequence 1: | NP_729801.1 | Gene: | Lmx1a / 39406 | FlyBaseID: | FBgn0052105 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002933659.1 | Gene: | arx / 100486727 | XenbaseID: | XB-GENE-483940 | Length: | 536 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 55/197 - (27%) |
---|---|---|---|
Similarity: | 75/197 - (38%) | Gaps: | 68/197 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 370 LQKGEQFMLR----DGQLFCYRHDLEKEMFLAAAAAQHCGFVGLD-EEDLLRPRDGRRGPKRPRT 429
Fly 430 ILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGG 494
Fly 495 GSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSSGYLGGLDSTFASQPLNPNL---PFSPDDY 556
Fly 557 PA 558 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lmx1a | NP_729801.1 | LIM1_Lmx1b | 275..327 | CDD:188757 | |
LIM | 333..388 | CDD:295319 | 6/21 (29%) | ||
Homeobox | 427..480 | CDD:278475 | 22/52 (42%) | ||
arx | XP_002933659.1 | Homeobox | 305..358 | CDD:365835 | 22/52 (42%) |
OAR | 500..518 | CDD:367680 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |