DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and arx

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:197 Identity:55/197 - (27%)
Similarity:75/197 - (38%) Gaps:68/197 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 LQKGEQFMLR----DGQLFCYRHDLEKEMFLAAAAAQHCGFVGLD-EEDLLRPRDGRRGPKRPRT 429
            |...|:.||.    ||:      |.|..:.|:|         |.| ||.:|     :|..:|.||
 Frog   262 LSPKEELMLHSSDADGK------DGEDSVCLSA---------GSDSEEGML-----KRKQRRYRT 306

  Fly   430 ILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGG 494
            ..||.|.::.:.:|.::..|....||.||....|:...|||||||:|||.:|.::...|....| 
 Frog   307 TFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHAPG- 370

  Fly   495 GSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSSGYLGGLDSTFASQPLNPNL---PFSPDDY 556
                                               ..:.|.|.   ||.||.|.|   || |..:
 Frog   371 -----------------------------------LPFPGPLS---ASHPLGPYLDASPF-PPHH 396

  Fly   557 PA 558
            ||
 Frog   397 PA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 6/21 (29%)
Homeobox 427..480 CDD:278475 22/52 (42%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 22/52 (42%)
OAR 500..518 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.