DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and nkx2-3

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_002937234.1 Gene:nkx2-3 / 100486189 XenbaseID:XB-GENE-852996 Length:328 Species:Xenopus tropicalis


Alignment Length:279 Identity:65/279 - (23%)
Similarity:97/279 - (34%) Gaps:80/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 MLRDGQLFCYRHDLEKEMFLAA-AAAQHCGFVGL----------------DEEDLLR-------- 416
            ||..|:...|....:|..||:| .||:..|.|||                :|||.||        
 Frog    60 MLAAGERCVYAGGEDKLPFLSAMGAAEPHGDVGLSPDRYVALRDPKEEDEEEEDSLREGGNKSCF 124

  Fly   417 --------------PRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRV 467
                          .|..:|..::||.:.:..|..:.:..|.|........||.||....|:...
 Frog   125 LNKSPDGEGKLEDPDRPKQRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLANSLKLTSTQ 189

  Fly   468 VQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSSGY 532
            |::||||:|.|.|:.::......|:.......|........|.|       .|:     |.|..|
 Frog   190 VKIWFQNRRYKCKRQRQDKSLEMGTHHPPPPRRVAVPVLVRDGK-------PCI-----GGSQSY 242

  Fly   533 LGGLDSTFASQPLNPNLPFSPDDYPA-----------NSNDSFCS--SDLSLDGSNFDQLDDDAD 584
            ....:.|.:        |:|.:.|||           |.|.::.|  |:|...|:        :.
 Frog   243 NTAYNVTAS--------PYSYNSYPAYSYNNSPSYNTNYNCNYASIPSNLHNTGT--------SP 291

  Fly   585 SLSLNNLELQSTSSSGNQH 603
            .::|.||...|.|.....|
 Frog   292 FVNLGNLSQISNSPQPQTH 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 4/10 (40%)
Homeobox 427..480 CDD:278475 17/52 (33%)
nkx2-3XP_002937234.1 Homeobox 149..203 CDD:365835 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.