DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and zfhx4

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_012820690.1 Gene:zfhx4 / 100486096 XenbaseID:XB-GENE-957673 Length:3559 Species:Xenopus tropicalis


Alignment Length:240 Identity:60/240 - (25%)
Similarity:88/240 - (36%) Gaps:41/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 DEEDLLRPRDGRRG-----PKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQ 469
            ||.:......|..|     .||.||.:|.:|.:.....:.....|.||:.:.:|::.||..||||
 Frog  2534 DENNCSEKEGGNSGEDQHRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAREVGLKKRVVQ 2598

  Fly   470 VWFQNQRAKMKKIQRKAKQNGGS--------------------------GGGSGSGRGTGNSSAT 508
            |||||.||:.:|.|.:|.....|                          ..|..:|.....|...
 Frog  2599 VWFQNTRARERKGQFRALGPAQSHKRCPFCRALFKAKSALESHIRSRHWNEGKQAGYSLPPSPLI 2663

  Fly   509 DDKDTNDKEDKCVK------QELGGDSSGYLGGLDSTFASQ--PLNPNLPFSPDDYPANSNDSFC 565
            ..:|..:..:|...      .:|...|...|....||..|:  .|:|....||..:.|..:|...
 Frog  2664 SMEDGGESPNKYTYFDYVSIPKLDPSSENDLPSTVSTPVSKTAELSPKNLLSPSSFRAECSDDID 2728

  Fly   566 SSDLSLDGSNFDQLDDDADSLSLNNLELQ--STSSSGNQHSHSHS 608
            :.:.....:.|||..:|.|..|..|..:.  :|...||....|.|
 Frog  2729 NINAPPADTGFDQSKNDFDETSSINTAISDATTGDEGNNDMDSTS 2773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 21/52 (40%)
zfhx4XP_012820690.1 C2H2 Zn finger 641..661 CDD:275368
C2H2 Zn finger 696..713 CDD:275368
C2H2 Zn finger 1372..1392 CDD:275371
C2H2 Zn finger 1400..1421 CDD:275371
C2H2 Zn finger 1516..1540 CDD:275368
C2H2 Zn finger 1568..1586 CDD:275368
HOX 2091..2146 CDD:197696
Homeobox 2190..2244 CDD:365835
COG5576 2527..2647 CDD:227863 31/112 (28%)
Homeobox 2557..2610 CDD:365835 21/52 (40%)
Homeobox 2880..2933 CDD:365835
C2H2 Zn finger 3348..3390 CDD:275371
C2H2 Zn finger 3392..3414 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.