DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and DUXB

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001338236.1 Gene:DUXB / 100033411 HGNCID:33345 Length:345 Species:Homo sapiens


Alignment Length:258 Identity:61/258 - (23%)
Similarity:96/258 - (37%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 YRHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPC 450
            |:...||:.......:||     |.:|.|  |::.|    :.:|.:|..|:.:...:|:::|.|.
Human    75 YKCFSEKDQTQGHDQSQH-----LTQEYL--PKEAR----QKQTFITWTQKNRLVQAFERNPFPD 128

  Fly   451 RKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTND 515
            ...|:.||:.|||....:|:|||.||:...|..|....|                ...|  |.|:
Human   129 IATRKKLAEQTGLQESRIQMWFQKQRSLYLKKSRMEPMN----------------LLVD--DPNE 175

  Fly   516 KEDKCVKQE-----LGGDSSGYLGGLDSTFASQPLNPNL-----PFSPDDYPANSNDSFC---SS 567
            :.|..|...     |..|||.|.....|:...:.|.|.|     |:.|..:..:...:..   .:
Human   176 RPDATVGWHPINLFLPTDSSHYFSCSHSSSGHETLPPVLPSTQAPWDPFRFHVSQGPNVMIMQPT 240

  Fly   568 DLSLDGSNFDQ-------------LDDDADSLSLNNLELQSTSSSGNQHS-------HSHSNP 610
            ....:|...||             |..|.|:.:...|:.|....:..:||       .|||.|
Human   241 QAVQEGEKSDQPLIIPNHLLTLPILTKDLDTPTPFWLQYQEEHQNHKEHSGSGVPQVKSHSQP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 1/1 (100%)
Homeobox 427..480 CDD:278475 18/52 (35%)
DUXBNP_001338236.1 homeodomain 16..72 CDD:238039
homeodomain 103..161 CDD:238039 20/61 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..314 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.