DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and PHB

DIOPT Version :10

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_181018.1 Gene:PHB / 818036 AraportID:AT2G34710 Length:852 Species:Arabidopsis thaliana


Alignment Length:109 Identity:22/109 - (20%)
Similarity:52/109 - (47%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 QQRRAFKASFEVSPKPCRKVRENLAKD----TGLSLRIVQVWFQNQRAKVKKIQKKAKQEPPSKG 411
            :|..|.:..:...|||....|:.|.::    :.:..:.::|||||:|.:.|:.::.|:.:..::.
plant    32 EQVEALERVYTECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEAARLQTVNRK 96

  Fly   412 ASDS----QDSQESLDSSLATKIKDEAHSDSESQLESPYSTTSD 451
            .:..    .:..:.|...::..:.:..|  .:.||.:...||:|
plant    97 LNAMNKLLMEENDRLQKQVSNLVYENGH--MKHQLHTASGTTTD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757
LIM 259..313 CDD:413332
COG5576 <332..439 CDD:227863 17/95 (18%)
HOX 341..393 CDD:197696 12/45 (27%)
PHBNP_181018.1 Homeodomain 25..83 CDD:459649 13/50 (26%)
bZIP <77..116 CDD:269834 4/38 (11%)
START_ArGLABRA2_like 168..384 CDD:176884
MEKHLA 705..851 CDD:462555
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.