powered by:
Protein Alignment CG4328 and hoxa9b
DIOPT Version :9
Sequence 1: | NP_648567.2 |
Gene: | CG4328 / 39405 |
FlyBaseID: | FBgn0036274 |
Length: | 544 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571608.1 |
Gene: | hoxa9b / 58048 |
ZFINID: | ZDB-GENE-000823-2 |
Length: | 258 |
Species: | Danio rerio |
Alignment Length: | 34 |
Identity: | 15/34 - (44%) |
Similarity: | 22/34 - (64%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 368 RKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQK 401
|..|..:|:...|:.|.|::||||:|.|:||..|
Zfish 219 RDRRYEVARLLNLTERQVKIWFQNRRMKMKKCNK 252
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3844 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.