DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and hoxb7a

DIOPT Version :9

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001108563.1 Gene:hoxb7a / 58044 ZFINID:ZDB-GENE-000329-2 Length:227 Species:Danio rerio


Alignment Length:238 Identity:49/238 - (20%)
Similarity:81/238 - (34%) Gaps:55/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 RVVENSFHEGCL-KCTACSLHLVHSCYAREGKLY------------CRVDYERLYIRNHCLGC-- 262
            :|..::|..|.. :.|:|:.    ||.::....|            ..|....:|.....|..  
Zfish    15 QVASSAFSTGVFPEQTSCAF----SCSSQRASGYGSASTGAPVSSSSSVSLPSMYTNGTSLSSHT 75

  Fly   263 -GLKIAADEL---VMRCHENVFHLKCFACVVCGALLK-----KGEQYVVKQGQLFCRFDYEKEVE 318
             |:...|.||   .:..|.::|.......|..|.|.|     |.||                   
Zfish    76 QGMYPTAYELGAVSLNMHSSLFDHPNLPMVSAGDLCKAQSSGKEEQ------------------- 121

  Fly   319 MLQGYDFYGD---ELFPPKLDGRRGPKRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGL 380
              :||....:   .::|.........||.|...:..|....:..|..:....|:.|..:|....|
Zfish   122 --RGYHQNNENNLRIYPWMRSTGADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCL 184

  Fly   381 SLRIVQVWFQNQRAKVKKIQKKAKQEPPSK---GASDSQDSQE 420
            :.|.:::||||:|.|.||..|...:..|:.   |..:.::..|
Zfish   185 TERQIKIWFQNRRMKWKKENKSTDRCSPAADQIGGDEEEEDDE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 9/50 (18%)
LIM 259..313 CDD:295319 14/64 (22%)
COG5576 <332..439 CDD:227863 23/92 (25%)
HOX 341..393 CDD:197696 14/51 (27%)
hoxb7aNP_001108563.1 Antp-type hexapeptide 134..139 1/4 (25%)
Homeobox 149..201 CDD:278475 14/51 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..227 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.