DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and ro

DIOPT Version :10

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:66 Identity:23/66 - (34%)
Similarity:38/66 - (57%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 DGRRGPKRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQ 400
            :||:  :|.||..:|:|....:..|..:....|..|..||:...|:...:::||||:|||.|:|:
  Fly   188 EGRQ--RRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIE 250

  Fly   401 K 401
            |
  Fly   251 K 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757
LIM 259..313 CDD:413332
COG5576 <332..439 CDD:227863 23/66 (35%)
HOX 341..393 CDD:197696 15/51 (29%)
roNP_524521.1 Homeodomain 196..248 CDD:459649 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.