DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and ftz

DIOPT Version :10

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:71 Identity:22/71 - (30%)
Similarity:32/71 - (45%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 KRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQE 406
            ||.|......|....:..|..:....|:.|.::|....||.|.:::||||:|.|.|| .:.....
  Fly   255 KRTRQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKK-DRTLDSS 318

  Fly   407 PPSKGA 412
            |...||
  Fly   319 PEHCGA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757
LIM 259..313 CDD:413332
COG5576 <332..439 CDD:227863 22/71 (31%)
HOX 341..393 CDD:197696 15/50 (30%)
ftzNP_477498.1 FTZ 1..248 CDD:397787
Homeodomain 255..311 CDD:459649 17/55 (31%)
KLF1_2_4_N <321..404 CDD:425360 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.