DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and LMX1B

DIOPT Version :9

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001167617.1 Gene:LMX1B / 4010 HGNCID:6654 Length:406 Species:Homo sapiens


Alignment Length:402 Identity:166/402 - (41%)
Similarity:219/402 - (54%) Gaps:82/402 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 GMGME----------LGLAMAS--PQLSQCAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLV 234
            |:.||          ||:.:.|  |..:.|..|.:||.||::|||.|:|:||.||:|.||...|.
Human    27 GIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALT 91

  Fly   235 HSCYAREGKLYCRVDYERLYIRNHCLGCGLKIAADELVMRCHENVFHLKCFACVVCGALLKKGEQ 299
            .|||.|:.||||:.||::|:... |.||..|||..|.|||..|.|:||.||.|.||...|:||::
Human    92 TSCYFRDRKLYCKQDYQQLFAAK-CSGCMEKIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDE 155

  Fly   300 YVVKQGQLFCRFDYEKEVEML-----------QGYDFYGDELFPPKLDGR------------RGP 341
            :|:|:|||.|:.|||||.::|           :..|..|| :.|.|..|.            |.|
Human   156 FVLKEGQLLCKGDYEKEKDLLSSVSPDESDSVKSEDEDGD-MKPAKGQGSQSKGSGDDGKDPRRP 219

  Fly   342 KRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQ- 405
            |||||||.||||||||||||||.||||||||.||.:||||:|:|||||||||||:||:.::.:| 
Human   220 KRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQ 284

  Fly   406 ------------EP-PSKGASDSQDSQESLDSSLATKIKDEAH-SDSESQL----ESPYSTT--- 449
                        || |.:|.     .||.|.|.:...:..... :..:.|:    :|||.::   
Human   285 QEQQNSQRLGQGEPGPGQGL-----GQEVLSSRMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPF 344

  Fly   450 SDGLTRMRCTIKDEQEQVPFNCMETNKENCNKNSEPILNTILGLS-YATFQQLMGPFAQTPMINP 513
            ..|||         ..|:|.|....:..:.:.:...:.:..||.| ..:.|..:|        ||
Human   345 QQGLT---------PPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGSLQARVG--------NP 392

  Fly   514 IDRLYSMQSSYF 525
            ||||||||||||
Human   393 IDRLYSMQSSYF 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 28/51 (55%)
LIM 259..313 CDD:295319 28/53 (53%)
COG5576 <332..439 CDD:227863 63/133 (47%)
HOX 341..393 CDD:197696 44/51 (86%)
LMX1BNP_001167617.1 LIM1_Lmx1b 56..108 CDD:188757 28/51 (55%)
LIM2_Lmx1a_Lmx1b 115..169 CDD:188764 28/53 (53%)
Homeobox 222..275 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6855
eggNOG 1 0.900 - - E33208_3BAC6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I3205
Isobase 1 0.950 - 0 Normalized mean entropy S3240
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323174at33208
OrthoFinder 1 1.000 - - FOG0001820
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105498
Panther 1 1.100 - - O PTHR24208
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 1 1.000 - - X1182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.