DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and Lim1

DIOPT Version :9

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster


Alignment Length:295 Identity:92/295 - (31%)
Similarity:130/295 - (44%) Gaps:81/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 CAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVHSCYAREGKLYCRVDYERLYIRNHCLGCG 263
            ||.|.:||.|::::.|:|.::|..|::|..|...|...|::||.|||||.|:.|.| ...|.|||
  Fly    27 CAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTDKCFSRESKLYCRNDFFRRY-GTKCSGCG 90

  Fly   264 LKIAADELVMRCHENVFHLKCFACVVCGALLKKGEQ-YVVKQGQLFCRFDYEKEVEMLQGYDFYG 327
            ..||..:||.:..:.||||.||.|.:|...|..||| ||:...:..|:.||........|::...
  Fly    91 QGIAPSDLVRKPRDKVFHLNCFTCCICRKQLSTGEQLYVLDDNKFICKDDYLLGKAPSCGHNSLS 155

  Fly   328 DELF-----------PPKL---------------------------------------------- 335
            |.|.           ||.|                                              
  Fly   156 DSLMGSASEDDDDDDPPHLRATALGLGVLGPNGPDSAGGPLGTSDISVQSMSTDSKNTHDDSDQG 220

  Fly   336 ------DGR-------------RGPKR--PRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTG 379
                  |||             .|.||  |||.:..:|....|.:|..:|||.|.:||.|||:||
  Fly   221 SLDGDPDGRGDSQAENKSPDDANGSKRRGPRTTIKAKQLEVLKTAFNQTPKPTRHIREQLAKETG 285

  Fly   380 LSLRIVQVWFQNQRAKVKKI-QKKAKQEPPSKGAS 413
            |.:|::||||||:|:|.::: |..:...||..|.:
  Fly   286 LPMRVIQVWFQNKRSKERRMKQITSMGRPPFFGGA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 22/51 (43%)
LIM 259..313 CDD:295319 23/54 (43%)
COG5576 <332..439 CDD:227863 40/150 (27%)
HOX 341..393 CDD:197696 27/53 (51%)
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 21/50 (42%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 23/54 (43%)
COG5576 185..324 CDD:227863 37/136 (27%)
Homeobox 250..303 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I4481
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.