DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and ind

DIOPT Version :10

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:141 Identity:37/141 - (26%)
Similarity:53/141 - (37%) Gaps:24/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 DYEKEVEMLQGYDFYGDELFPP-----KLDGRRGP--------------KRPRTILNTQQRRAFK 357
            ||....:..||..|..:....|     |.....||              ||.||...:.|....:
  Fly   179 DYTNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLELE 243

  Fly   358 ASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQEPPSKGAS-DSQDSQES 421
            ..|..:....|..|..:|....||.:.|::||||:|.|    |||...|.|:...| :|..|.::
  Fly   244 REFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVK----QKKGGSESPTFNLSTNSNGSPQA 304

  Fly   422 LDSSLATKIKD 432
            ...|...|:.:
  Fly   305 SPVSPQVKVHE 315

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757