DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and phx1

DIOPT Version :9

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_593776.1 Gene:phx1 / 2542405 PomBaseID:SPAC32A11.03c Length:942 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:50/194 - (25%)
Similarity:79/194 - (40%) Gaps:26/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 PKRPRTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQ 405
            ||..:..|...|.......|.....|...:||.:.::..:..|.|.:||||:|||.|.|.:  :|
pombe   166 PKSKKQRLTADQLAYLLREFSKDTNPPPAIREKIGRELNIPERSVTIWFQNRRAKSKLISR--RQ 228

  Fly   406 EPPSKGASDSQDSQESLDSSLATKIKDEAHSDSESQLESPYSTTSDGLTRMR---------CTIK 461
            |...:.....|...:||:..::.....|..|.|.:   |||   ..|:...|         .|.|
pombe   229 EEERQRILREQRELDSLNQKVSQAFAHEVLSTSPT---SPY---VGGIAANRQYANTLLPKPTRK 287

  Fly   462 DEQEQVPFNCMETNKENCNKNSE-PILNTILGLSYATFQQLMGPFAQTPMINPIDRLYSMQSSY 524
            .....:....|:::.|.|...|: ||..::    .:|:...:.|.| .|:.:  .|.|| .|||
pombe   288 TGNFYMKSGPMQSSMEPCIAESDIPIRQSL----SSTYYNSLSPNA-VPVSS--QRKYS-ASSY 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757
LIM 259..313 CDD:295319
COG5576 <332..439 CDD:227863 26/97 (27%)
HOX 341..393 CDD:197696 14/51 (27%)
phx1NP_593776.1 COG5576 116..272 CDD:227863 31/113 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.