DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and Pou3f1

DIOPT Version :9

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_035271.1 Gene:Pou3f1 / 18991 MGIID:101896 Length:449 Species:Mus musculus


Alignment Length:393 Identity:77/393 - (19%)
Similarity:118/393 - (30%) Gaps:139/393 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GRSASTKAGVAHNDKMASVSRTVNGSCSNHNSSNSSSSSSTNSSSNMAINKQPMGM--------G 119
            |......|.:.|.....:.:....|..::|.....|.|.......    ..||:|:        |
Mouse   105 GGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGH----QPQPLGLYAQAAYPGG 165

  Fly   120 PGTG-TGM----GTGTGHG---------------PGPPNHTHCNRITLGECSLNGMDGFATPAAP 164
            .|.| .||    |.|.|.|               |.||.|...:....|.....|:...|....|
Mouse   166 GGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHP 230

  Fly   165 PSASNTPQAPLGMASNSGMGMELGL-----AMASPQLSQCAHCCQPICDRYIMRVVENSFHEGCL 224
            .:              .|.|..:|.     |.:|..|.|.|       .::..|.::..|.:..:
Mouse   231 GA--------------GGGGSSVGEHSDEDAPSSDDLEQFA-------KQFKQRRIKLGFTQADV 274

  Fly   225 KCTACSLHLVHSCYAREGKLY-----CRVDYERLYIRNHCLGCGLKIAADELVMRCHENVFHLKC 284
            .....:|:         |.::     ||.:..:|..:|.|                     .|| 
Mouse   275 GLALGTLY---------GNVFSQTTICRFEALQLSFKNMC---------------------KLK- 308

  Fly   285 FACVVCGALLKKGEQYVVKQGQLFCRFDYEKEVEMLQGYDFYGDELFPPKLD-----GRRGPKRP 344
                   .||.|                :.:|.:...|        .|..||     ||:  ::.
Mouse   309 -------PLLNK----------------WLEETDSSSG--------SPTNLDKIAAQGRK--RKK 340

  Fly   345 RTILNTQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQEPPS 409
            ||.:....:.|.::.|...|||.......||....|...:|:|||.|:|.|.|::       .|:
Mouse   341 RTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRM-------TPA 398

  Fly   410 KGA 412
            .||
Mouse   399 AGA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 7/56 (13%)
LIM 259..313 CDD:295319 6/53 (11%)
COG5576 <332..439 CDD:227863 26/86 (30%)
HOX 341..393 CDD:197696 15/51 (29%)
Pou3f1NP_035271.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..152 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..251 13/80 (16%)
POU 245..319 CDD:197673 20/134 (15%)
Homeobox 340..393 CDD:278475 17/52 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..449 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.