DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4328 and lmx1b.1

DIOPT Version :9

Sequence 1:NP_648567.2 Gene:CG4328 / 39405 FlyBaseID:FBgn0036274 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_002937918.1 Gene:lmx1b.1 / 100495130 XenbaseID:XB-GENE-494750 Length:400 Species:Xenopus tropicalis


Alignment Length:401 Identity:162/401 - (40%)
Similarity:213/401 - (53%) Gaps:102/401 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 MGMELGLAMASPQLSQCAH------CCQPICDRYIMRVVENSFHEGCLKCTACSLHLVHSCYARE 241
            :|:.||        |:|.|      |.:||.||::|||.|.|:||.||:||.|...|..|||.|:
 Frog    42 LGVLLG--------SECQHQAVCEGCQRPISDRFLMRVNEASWHEECLQCTVCQQPLTTSCYFRD 98

  Fly   242 GKLYCRVDYERLYIRNHCLGCGLKIAADELVMRCHENVFHLKCFACVVCGALLKKGEQYVVKQGQ 306
            .||:|:.||::|:... |.||..|||..|.|||..|.|:||.||.|.||...|:||:::|:|:||
 Frog    99 RKLFCKQDYQQLFAAK-CSGCMEKIAPTEFVMRALECVYHLSCFCCCVCERQLRKGDEFVLKEGQ 162

  Fly   307 LFCRFDYEKEVEML-----------QGYDFYGDELFPPKL---------DGR--RGPKRPRTILN 349
            |.|:.|||||.::|           :..|..|| :.|.|.         ||:  |.||||||||.
 Frog   163 LLCKSDYEKEKDLLSSGSPDDSDSVKSDDEEGD-VKPGKCHVNQGKGSDDGKDPRRPKRPRTILT 226

  Fly   350 TQQRRAFKASFEVSPKPCRKVRENLAKDTGLSLRIVQVWFQNQRAKVKKIQKKAKQEPPSKGASD 414
            ||||||||||||||.||||||||.||.:||||:|:|||||||||||:||:.::.:|:      .:
 Frog   227 TQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQ------QE 285

  Fly   415 SQDSQESLDSSLATKIKDEAHSDSESQLESP-----------YSTT--SDGLTRMRCTIKDEQEQ 466
            .|:||......:::::  |....|.:.|..|           |||.  ..|||         ..|
 Frog   286 QQNSQRLGQEVMSSRM--EGMMTSYAPLAPPQQQIVTMDQNSYSTDPFQQGLT---------PPQ 339

  Fly   467 VPFNCME-----------------TNKENCNKNSEPILNTILGLSYATFQQLMGPFAQTPMINPI 514
            :|.:.|.                 |:..:|...|..:         .:.|..:|        |||
 Frog   340 MPGDHMNPYGNDTIFHDIDSDTSLTSLSDCFLASSEV---------TSMQARVG--------NPI 387

  Fly   515 DRLYSMQSSYF 525
            |||||||||||
 Frog   388 DRLYSMQSSYF 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4328NP_648567.2 LIM1_Lmx1b 199..251 CDD:188757 28/57 (49%)
LIM 259..313 CDD:295319 28/53 (53%)
COG5576 <332..439 CDD:227863 60/117 (51%)
HOX 341..393 CDD:197696 44/51 (86%)
lmx1b.1XP_002937918.1 LIM1_Lmx1b 56..108 CDD:188757 26/51 (51%)
LIM2_Lmx1a_Lmx1b 115..169 CDD:188764 28/53 (53%)
Homeobox 221..275 CDD:365835 45/53 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6758
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I3208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323174at33208
OrthoFinder 1 1.000 - - FOG0001820
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24208
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 1 1.000 - - X1182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.