DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and INP52

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_014293.1 Gene:INP52 / 855618 SGDID:S000005050 Length:1183 Species:Saccharomyces cerevisiae


Alignment Length:353 Identity:109/353 - (30%)
Similarity:165/353 - (46%) Gaps:72/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 RVLPQKE-------ITVFVGTWNMNGHSPPKQLNDFVLPANVEHVPDIVVMGTQE---------- 431
            |:|..:|       |.:||||:|:||:|....|:.::.|...:..||:||:|.||          
Yeast   577 RLLESEEKFTTHSNINLFVGTFNVNGNSRRADLSKWLFPIGDKFKPDVVVLGLQEVIELTAGSIL 641

  Fly   432 ---STPDRFEWEVTIQETLG---PSHVLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSVRTGS 490
               .|...| ||..:.:.|.   ..::|.....:.:|.:..:.|.|..:  ::.|....:.:||.
Yeast   642 NADYTKSSF-WETMVTDCLNQYEEKYLLLRVEQMSSLLILFFARSDRAY--NIKEVGGSTKKTGF 703

  Fly   491 AFRT--KGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNLPNQRHKNKDV 553
            ...|  ||||||.|....||..||.:||:|....:.||.:|...|...:..||:.....|     
Yeast   704 GGITGNKGAVAIRFDYGATSFCFVNTHLSAGASNIDERRNDYNNIYRNITFPRSKTIPHH----- 763

  Fly   554 TQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGY----MHTDQLTSVLADGAAFRG 614
                |::||.||||:|:....:::...::..|        .||    :..||||..:.:|..|:|
Yeast   764 ----DSLFWLGDLNYRITLTNDEVRRELRAQK--------DGYIDRLLQYDQLTQEINEGVVFQG 816

  Fly   615 FMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGVSTPTQPHV 679
            |.|..:.|.||||||.|:.|:|||.|.|.|::||||:||          .:.|.|          
Yeast   817 FKEPTLQFRPTYKYDYGTDNYDTSEKARTPSWTDRIIYK----------GENLHP---------- 861

  Fly   680 QCLLYDSVPSITTSDHKPVWALFRTLIR 707
              |.|...| :..||||||:|.:|..::
Yeast   862 --LAYSDAP-LKISDHKPVYAAYRANVK 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 106/344 (31%)
INP52NP_014293.1 COG5329 1..628 CDD:227637 18/50 (36%)
COG5411 564..1052 CDD:227698 109/353 (31%)
Aim21 <978..1166 CDD:371558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.