DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and INP51

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_012264.3 Gene:INP51 / 854815 SGDID:S000001264 Length:946 Species:Saccharomyces cerevisiae


Alignment Length:341 Identity:102/341 - (29%)
Similarity:157/341 - (46%) Gaps:62/341 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 QKEITVFVGTWNMNGHSPPKQLNDFVLPANV---EHVPDIVVMGTQ---ESTPD---------RF 437
            :|:|::|.||:|::|..|...:.|::.|.::   :.:.|:.|:|.:   |.||.         |.
Yeast   524 EKDISIFAGTFNISGKIPKDDIKDWIFPKSMSKEDEMADLYVIGLEEVVELTPGHMLATDPYVRQ 588

  Fly   438 EWEVTIQETL-GP----SHVLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSVRT--GSAFRTK 495
            .||..|...| ||    .::...:|.||.:.|.::|..  ..|..|........:|  |.....|
Yeast   589 FWEKKILTLLNGPGRKKKYIRLWSTQLGGILLLLFMNE--TEYSKVKHIEGDVKKTGFGGMASNK 651

  Fly   496 GAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNLPNQRHKNKDVTQNFDNV 560
            ||||:||....|....:.|||.|..:.|::|.:|.|.|..::...:.|..:.|         |.:
Yeast   652 GAVAVSFKYSATRFCVLVSHLAAGLENVEQRHNDYKTIAKSIRFSKGLRIKDH---------DAI 707

  Fly   561 FWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGYMHTDQLTSVLADGAAFRGFMEANITFPPT 625
            .|.||.|:|:....|.:...|.:.::.       .....|||...:..|.:|..|.|..|.||||
Yeast   708 IWMGDFNYRILMSNEDVRRKIVSKEYA-------SLFEKDQLNQQMIAGESFPYFHEMAIDFPPT 765

  Fly   626 YKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGVSTPTQPHVQCLLYDSVPSI 690
            ||:|||::|:|||.|.|.||:|||||     .:|.|:.:                 |.|.....|
Yeast   766 YKFDPGTKNYDTSEKMRIPAWTDRIL-----SRGEVLEQ-----------------LEYKCCEDI 808

  Fly   691 TTSDHKPVWALFRTLI 706
            ..|||:||:|:||..:
Yeast   809 LFSDHRPVYAIFRARV 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 100/336 (30%)
INP51NP_012264.3 COG5329 1..501 CDD:227637
COG5411 498..946 CDD:227698 102/341 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.