DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and INP53

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_014752.3 Gene:INP53 / 854276 SGDID:S000005635 Length:1107 Species:Saccharomyces cerevisiae


Alignment Length:389 Identity:116/389 - (29%)
Similarity:176/389 - (45%) Gaps:83/389 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 STSLLGPSELSRVLPQKEITVFVGTWNMNGHSPPKQLNDFVLPANVEHVPDIVVMGTQE------ 431
            ||.|...|:  :......|.:.:|::|:||.:....|:.::.|...:..|||||:|.||      
Yeast   550 STKLQSMSD--KFTSTSNINLLIGSFNVNGATKKVDLSKWLFPIGEKFKPDIVVLGLQEVIELSA 612

  Fly   432 -------STPDRFEWEVTIQETLG---PSHVLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSV 486
                   .:...| ||..:.:.|.   ..::|.....:.:|.:..:::.|...|....|.|:.  
Yeast   613 GSILNADYSKSSF-WENLVGDCLNQYDDKYLLLRVEQMTSLLILFFVKADKAKYVKQVEGATK-- 674

  Fly   487 RTGSAFR----TKGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNLPNQR 547
            :||  ||    .||||:|.|....||..||.|||.|....|:||.||.:.|:..:...|......
Yeast   675 KTG--FRGMAGNKGAVSIRFEYGATSFCFVNSHLAAGATNVEERRSDYESIVRGITFTRTKMIPH 737

  Fly   548 HKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGY----MHTDQLTSVLAD 608
            |         |::||.||:|:|:..|.|.:...:.|.:        .||    :|.||||..:..
Yeast   738 H---------DSIFWLGDMNYRINLPNEDVRRELLNQE--------EGYIDKLLHFDQLTLGINS 785

  Fly   609 GAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGVST 673
            |:.|.||.|..:.|.||||||||:..:|:|.|:|.|::||||:||          .:.|:|    
Yeast   786 GSVFEGFKEPTLKFRPTYKYDPGTGTYDSSEKERTPSWTDRIIYK----------GENLLP---- 836

  Fly   674 PTQPHVQCLLYDSVPSITTSDHKPVWALFRTLIRAGTDAIPLAAGLFSRDIYLEGMRRRLNNQY 737
                    |.|...| |..|||:||:|.:|..|....|...|:            :::||..:|
Yeast   837 --------LSYSDAP-IMISDHRPVYAAYRAKITFVDDKERLS------------LKKRLFTEY 879

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 105/339 (31%)
INP53NP_014752.3 COG5329 1..603 CDD:227637 16/54 (30%)
INPP5c_ScInp51p-like 566..858 CDD:197324 105/336 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.