DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and INP54

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_014576.1 Gene:INP54 / 854089 SGDID:S000005426 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:383 Identity:94/383 - (24%)
Similarity:146/383 - (38%) Gaps:116/383 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 VFVGTWNM-------NGHSPPKQL----NDFVLPANVEHVPDIVVMGTQESTP------------ 434
            |.|.|:|.       |..:..|||    :|.:....::   |:.|:|.||..|            
Yeast     8 VSVTTFNCGKEFPVENSKAIVKQLLFPYDDGISQLELQ---DLYVLGFQEVVPIWQGSFPAVNRD 69

  Fly   435 --DRFEWEVT------IQETLG-PSHVLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSVRTGS 490
              ||......      :..|.| ..:......:||.:.:.|....:.:   .|.:|  :..|.|.
Yeast    70 LIDRITTTAVNCLNEKVSATQGDEQYSCLGVNSLGAITIIVLYNNNAL---KVKDD--ILKRNGK 129

  Fly   491 A--FRT--KGAVAISFCLFGTS------MLFVTSHLTAHQ--QKVKERVSDVKRIINALDLPRNL 543
            .  |.|  ||...|||.:....      ..::.:||.|::  ....:|:.|.|||::.:      
Yeast   130 CGWFGTHLKGGTLISFQMTRNGEENWERFSYICAHLNANEGVNNRNQRIDDYKRIMSEV------ 188

  Fly   544 PNQRHKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGYMHTDQLTSVL-- 606
                 .:.:|.:: |:.|:.||||||           :.:|..|..:     |..|..|..:|  
Yeast   189 -----CDSEVAKS-DHFFFLGDLNFR-----------VTSTYDPTTN-----YSSTTTLRRLLEN 231

  Fly   607 ----------ADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLV 661
                      .|....:||.|..||||||||:....:  :|.:.:|.|::.||||||        
Yeast   232 HEELNLLRKGEDEPLCKGFQELKITFPPTYKFKLFEK--ETYNTKRIPSWCDRILYK-------- 286

  Fly   662 IRRQTLVPGVSTPTQPHVQCLLYDSVP---SITTSDHKPVWALFRTLIRAGTDAIPLA 716
                    ..:.||  ..|...|.|||   ::..|||:||....|.....|| .:||:
Yeast   287 --------SYAVPT--FAQEGTYHSVPRSNALLFSDHQPVNLTVRLPRSTGT-PVPLS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 89/368 (24%)
INP54NP_014576.1 COG5411 1..371 CDD:227698 94/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.