DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and 5PTASE11

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_175182.2 Gene:5PTASE11 / 841160 AraportID:AT1G47510 Length:334 Species:Arabidopsis thaliana


Alignment Length:358 Identity:107/358 - (29%)
Similarity:164/358 - (45%) Gaps:78/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 ARERSYLDGRLGSTSLLGPSELSRVLPQKEITVFVGTWNMNGHSPPKQLNDFVLPANVEHVPDIV 425
            |:..|..|| :.:...:.....||   :.::.:.:.||||||:...:.|.:.|   ..|...|::
plant    28 AKNSSSHDG-IKTIEAVNSCSFSR---KADLCIRIITWNMNGNVSYEDLVELV---GKERKFDLL 85

  Fly   426 VMGTQESTPDRFEWEVTIQETLGPSHVLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSVRT-- 488
            |:|.||:  .:...:..:|....|:|.|.....|.::.|          |...|:::...|:.  
plant    86 VVGLQEA--PKANVDQLLQTASSPTHELLGKAKLQSVQL----------YLFGPKNSHTLVKELK 138

  Fly   489 ----------GSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNL 543
                      |...|.||||||........|:|::.||:||.:||.:|.::::.|.|:| |||: 
plant   139 AERYSVGGCGGLIGRKKGAVAIRINYDDIKMVFISCHLSAHAKKVDQRNTELRHIANSL-LPRD- 201

  Fly   544 PNQRHKNKDVTQNFDNVFWCGDLNFRL----GEPREKLLEWIQNTKFPLPSHLPHGYMHTDQLTS 604
                .:.:|:|      .|.||||:|:    ..|...|   |||       ||....:..|||..
plant   202 ----KRKRDLT------VWLGDLNYRIQDVSNHPVRSL---IQN-------HLQSVLVSKDQLLQ 246

  Fly   605 VLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVP 669
            ....|..|:|:.|..:.|.|||||:.||.::|||.|.|.||:|||||:|.:...           
plant   247 EAERGEIFKGYSEGTLGFKPTYKYNVGSSDYDTSHKIRVPAWTDRILFKIQDTD----------- 300

  Fly   670 GVSTPTQPHVQCLL--YDSVPSITTSDHKPVWA 700
                    ::|..|  |||:..:..||||||.|
plant   301 --------NIQATLHSYDSIDQVYGSDHKPVKA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 101/332 (30%)
5PTASE11NP_175182.2 EEP 56..325 CDD:294334 100/324 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1945
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000945
OrthoInspector 1 1.000 - - oto2997
orthoMCL 1 0.900 - - OOG6_104600
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.