DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and AT2G01900

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001323555.1 Gene:AT2G01900 / 814721 AraportID:AT2G01900 Length:425 Species:Arabidopsis thaliana


Alignment Length:432 Identity:113/432 - (26%)
Similarity:167/432 - (38%) Gaps:121/432 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 RQGSGSN--------LARQTLMAAHALNLIPADNARERSYLDGRLGSTSLLGPSELSRVLPQKEI 391
            |:..|||        ...|.|:.|..|       |.||        |.|:|.....:.:|..|  
plant    20 RKSLGSNNFVADFPPNTDQKLIEASGL-------ADER--------SKSILHNQHKTTLLNYK-- 67

  Fly   392 TVFVGTWNMNGHSPPKQLNDFVLPANVEHVPDIVVMGTQESTPDR-------------FEWEVTI 443
             |||.|||:.|..|...|:...|....:...||.|:|.||..|.|             .:|...|
plant    68 -VFVSTWNVGGIVPDDGLDMEDLLETHKTPCDIYVLGFQEVVPLRASNVLGSDNNKVSTKWNSLI 131

  Fly   444 QETLGPS----------------------HVLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSV 486
            ::.|...                      ..:.....:|.| :.|::|.||..|...|..:.:..
plant   132 RDALNKRARPHRDEDLSESKGINGISQDFRCIISKQMVGIL-ITVWVRGDLWPYIRYPSVSCVGC 195

  Fly   487 RTGSAFRTKGAVAISFCLFGTSMLFVTSHLTA--HQQKVKERVSDVKRII--------NALDLPR 541
            ........||:|::.|.|..|:..||.|||.:  ..:..::|.|||..|:        ::||||:
plant   196 GIMGCLGNKGSVSVRFQLHETTFCFVCSHLASGGRDRDERQRNSDVNEILARSSFPRGSSLDLPK 260

  Fly   542 NLPNQRHKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGYMHTDQLTSVL 606
            .:           .:.|.|.:.||||:|:..|.||....:::.|:.:       .:..|||...:
plant   261 KI-----------LDHDRVIFLGDLNYRISLPEEKTRLLVESKKWNI-------LLENDQLRMEI 307

  Fly   607 ADGAAFRGFMEANITFPPTYKYDPGSQ------NFDTSSKQRAPAYTDRIL-YKYRQMQGLVIRR 664
            .:|..|||:.|..:.|.|||||.|.|.      .:....|:||||:.|||: |.....|....|.
plant   308 MNGQIFRGWQEGIVKFAPTYKYVPNSDLYYGCITYKKDEKKRAPAWCDRIIWYGNGLKQHEYTRG 372

  Fly   665 QTLVPGVSTPTQPHVQCLLYDSVPSITTSDHKPVWALFRTLI 706
            :|.:                        |||:||.|:|.|.|
plant   373 ETKI------------------------SDHRPVKAIFTTEI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 95/367 (26%)
AT2G01900NP_001323555.1 EEP 3..392 CDD:412407 113/432 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.