powered by:
Protein Alignment INPP5E and sh2d1aa
DIOPT Version :9
Sequence 1: | NP_001261753.1 |
Gene: | INPP5E / 39404 |
FlyBaseID: | FBgn0036273 |
Length: | 747 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001108163.1 |
Gene: | sh2d1aa / 797046 |
ZFINID: | ZDB-GENE-060526-212 |
Length: | 106 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 29/71 - (40%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 476 CSVPEDASMSVRTGSAFRTKGAVAISFCLFG---TSMLFVTSHLTAHQQK--VKERV-SDVKRII 534
||...|.|..:| .:..:.||..:.....| |..:|....|...:.. :|||: .:|..:|
Zfish 21 CSTGRDGSYLIR--DSLSSAGAYCVCVLCDGWVYTYRIFNKGGLWTIEMAPGMKERLFRNVSNLI 83
Fly 535 NALDLP 540
.|..:|
Zfish 84 AAFKMP 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
INPP5E | NP_001261753.1 |
EEP |
387..703 |
CDD:321002 |
18/71 (25%) |
sh2d1aa | NP_001108163.1 |
SH2 |
2..103 |
CDD:301589 |
18/71 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5411 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.