DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and OCRL

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001305713.1 Gene:OCRL / 4952 HGNCID:8108 Length:902 Species:Homo sapiens


Alignment Length:471 Identity:129/471 - (27%)
Similarity:187/471 - (39%) Gaps:99/471 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 NIATQPDGIEHIEEQPGVRFMSHENMTLQRQGSGSNLARQTLMAAHALNLIPADNARERSYLDGR 370
            |...||.||.  .|.|...|  ..|..|.|:...||..:..:........:|...:.:|..|   
Human   166 NSQNQPTGIH--REPPPPPF--SVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGL--- 223

  Fly   371 LGSTSLLGPSELSRVLPQKE--------ITVFVGTWNMNGHSPPKQLNDFVLPANVE-HVPDIVV 426
                       :..:|.::|        ...||||||:||.||...|..::   |.: :.|||..
Human   224 -----------IKHILAKREKEYVNIQTFRFFVGTWNVNGQSPDSGLEPWL---NCDPNPPDIYC 274

  Fly   427 MGTQE---STPDRF--------EWEVTIQETL--GPSHVLFHATTLGTLHLAVYMRRDLIWYCSV 478
            :|.||   ||...|        ||.:.::..|  ...:.......|..:.|.::.|:|...|  :
Human   275 IGFQELDLSTEAFFYFESVKEQEWSMAVERGLHSKAKYKKVQLVRLVGMMLLIFARKDQCRY--I 337

  Fly   479 PEDASMSVRTG--SAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPR 541
            .:.|:.:|.||  .....||.||:.|....|:...|.|||.||.:..:.|..|.|.|...:... 
Human   338 RDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFV- 401

  Fly   542 NLPNQRHKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGYMHTDQLTSVL 606
             :|||.....::.:: :.|.|.||||:||..|....::.:.|.|     .|.. .:..|||....
Human   402 -VPNQTLPQLNIMKH-EVVIWLGDLNYRLCMPDANEVKSLINKK-----DLQR-LLKFDQLNIQR 458

  Fly   607 ADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGV 671
            ....||..|.|..|.|.||||||..:..:|:|.|.|.||:.||||::                  
Human   459 TQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCRVPAWCDRILWR------------------ 505

  Fly   672 STPTQPHVQCLLYDSVPSITTSDHKPVWALF--------------------RTLIRAGTDAIPLA 716
                ..:|..|.|.|...:.|||||||.|||                    |.:.|...|.:| :
Human   506 ----GTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRIMDRMENDFLP-S 565

  Fly   717 AGLFSRDIYLEGMRRR 732
            ..|..|:...|.::.|
Human   566 LELSRREFVFENVKFR 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 104/359 (29%)
OCRLNP_001305713.1 PH_OCRL1 15..116 CDD:270182
Clathrin box 1 74..78
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..188 9/25 (36%)
5-phosphatase 238..564 106/361 (29%)
INPP5c_INPP5B 241..534 CDD:197327 103/328 (31%)
ASH 565..679 4/17 (24%)
RhoGAP_OCRL1 669..897 CDD:239845
Clathrin box 2 703..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.