DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and SH2D1A

DIOPT Version :10

Sequence 1:NP_648566.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_002342.1 Gene:SH2D1A / 4068 HGNCID:10820 Length:128 Species:Homo sapiens


Alignment Length:89 Identity:18/89 - (20%)
Similarity:33/89 - (37%) Gaps:31/89 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 LPHGYMHTDQLTSVLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQ 656
            |.|||::|.:::..                       :.||.:.:|     ||....|.   :|:
Human    46 LYHGYIYTYRVSQT-----------------------ETGSWSAET-----APGVHKRY---FRK 79

  Fly   657 MQGLVIRRQTLVPGVSTPTQPHVQ 680
            ::.|:...|....|:..|.|..|:
Human    80 IKNLISAFQKPDQGIVIPLQYPVE 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_648566.1 EEP 387..703 CDD:469791 18/89 (20%)
SH2D1ANP_002342.1 SH2_SAP1a 2..104 CDD:198263 18/89 (20%)
Interaction with FYN SH3 domain. /evidence=ECO:0000250|UniProtKB:O88890 67..92 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..128
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.