DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and Synj

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001246454.1 Gene:Synj / 37517 FlyBaseID:FBgn0034691 Length:1218 Species:Drosophila melanogaster


Alignment Length:442 Identity:137/442 - (30%)
Similarity:192/442 - (43%) Gaps:117/442 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 QGSGSNLARQTLMAAHAL--NLIPADNARERSYLDGRLGST---------SLLGPSEL----SRV 385
            || ||.|......||..:  ||:  ||:::.:.....:|||         .:|.||.:    :.|
  Fly   460 QG-GSKLMDGARSAARTIQNNLL--DNSKQEAIDVLLVGSTLSSELADRARILLPSNMLHAPTTV 521

  Fly   386 LPQ--KEIT---------VFVGTWNMNG--------------------H--SPPKQLNDFVLPA- 416
            |.:  |..|         |.|||:|:||                    |  :..|.|.|...|: 
  Fly   522 LRELCKRYTEYVRPRMARVAVGTYNVNGGKHFRSIVFKDSLADWLLDCHALARSKALVDVNNPSE 586

  Fly   417 NVEHVPDIVVMGTQE------------STPDRFEWEVTIQETLG--PSHVLFHATTLGTLHLAVY 467
            ||:|..||..:|.:|            ||.:...|...:|:|:.  ..:||.....|..:.|.:|
  Fly   587 NVDHPVDIYAIGFEEIVDLNASNIMAASTDNAKLWAEELQKTISRDNDYVLLTYQQLVGVCLYIY 651

  Fly   468 MR-------RDLIWYCSVPEDASMSVRT--GSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQKV 523
            :|       ||:...|         |:|  |.|...|||.||.|.|.||||.||.:|..|.|.:|
  Fly   652 IRPEHAPHIRDVAIDC---------VKTGLGGATGNKGACAIRFVLHGTSMCFVCAHFAAGQSQV 707

  Fly   524 KERVSDVKRIINALDLPRNLPNQRHKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPL 588
            .||.:|...|...|..|.....:.|         |.||||||.|:|:...:::|.|.::|     
  Fly   708 AERNADYAEITRKLAFPMGRTLKSH---------DWVFWCGDFNYRIDMEKDELKECVRN----- 758

  Fly   589 PSHLPHGYMHT----DQLTSVLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDR 649
                  |.:.|    |||......|..|..|:|..|||.||||||..|.::|||.||||||:|||
  Fly   759 ------GDLSTVLEFDQLRKEQEAGNVFGEFLEGEITFDPTYKYDLFSDDYDTSEKQRAPAWTDR 817

  Fly   650 ILYKYRQMQGLVIRRQTLVPGVSTPTQPHVQCLLYDSVPSITTSDHKPVWAL 701
            :|::         ||:.|..|....:..:...|::.....:..|||:||.|:
  Fly   818 VLWR---------RRKALAEGDFAASAWNPGKLIHYGRSELKQSDHRPVIAI 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 118/376 (31%)
SynjNP_001246454.1 Syja_N 61..353 CDD:280532
INPP5c_Synj 538..863 CDD:197323 116/361 (32%)
DUF1866 862..1008 CDD:286093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.