DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and Inpp5b

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001094225.1 Gene:Inpp5b / 362590 RGDID:1311511 Length:916 Species:Rattus norvegicus


Alignment Length:457 Identity:129/457 - (28%)
Similarity:205/457 - (44%) Gaps:83/457 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 PLQAATEPGDIKRATTPQHMSSPNI-ATQPD--GIEHIEEQPGVRFMSHENMTLQRQGSG----S 340
            |.:..::|| .:....|......|: :::|:  |:..:::..|.|.......:|.||...    :
  Rat   159 PREWNSDPG-TRSGFAPIGGGGYNVDSSRPNGRGLLPLDQSSGARCPDKPENSLTRQNRSKAEIT 222

  Fly   341 NLARQTLMA----AHALNL--IPADNARERSYLDGRLGSTSLLGPSELSRVLPQKEITVFVGTWN 399
            ::.|.:.:.    ||.|::  ....:...||:|..:.|..:.:           :....||||:|
  Rat   223 DMVRSSTITVSDKAHILSMQKFGLRDTMVRSHLLQKEGEYTYI-----------QNFRFFVGTYN 276

  Fly   400 MNGHSPPKQLNDFVLPANVEHVPDIVVMGTQE-----------STPDRFEWEVTIQETLGP--SH 451
            :||.||.:.|..::  ::....||:..:|.||           .||...||...:.|:|.|  .:
  Rat   277 VNGQSPKECLRPWL--SSDTKAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSESLHPDAKY 339

  Fly   452 VLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSVRTGSAFR--TKGAVAISFCLFGTSMLFVTS 514
            .......|..:.|.:|::::...|.|  |..:.:|.||...|  .||.|||.|.|..||:..|.|
  Rat   340 AKVKLIRLVGIMLLLYVKQEHAAYIS--EVEAETVGTGIMGRMGNKGGVAIRFQLHNTSICVVNS 402

  Fly   515 HLTAHQQKVKERVSDVKRIINALDLPR---NLPNQRHKNKDVTQNFDNVFWCGDLNFRLGE-PRE 575
            ||.||.::.:.|..|.:.|.:.:...:   :||.......||      :.|.||||:|:.| ..|
  Rat   403 HLAAHTEEYERRNQDYRDICSRMQFSQVDPSLPPLTISKHDV------ILWLGDLNYRIEELDVE 461

  Fly   576 KLLEWIQNTKFPLPSHLPHGYMHTDQLTSVLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSK 640
            |:.:.::...|       |.....|||...:|....|.||.|..|||.||||||.||.|:|||.|
  Rat   462 KVKKLVEEKAF-------HTLYAHDQLKIQVAAKTVFEGFTEGEITFQPTYKYDTGSDNWDTSEK 519

  Fly   641 QRAPAYTDRILYKYRQMQGLVIRRQTLVPGVSTPTQPHVQCLLYDSVPSITTSDHKPVWALFRTL 705
            .||||:.||:|::.:                      ::..|.|.|..|:.|||||||.::|...
  Rat   520 CRAPAWCDRVLWRGK----------------------NISQLSYQSHMSLKTSDHKPVSSVFEIG 562

  Fly   706 IR 707
            :|
  Rat   563 VR 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 107/334 (32%)
Inpp5bNP_001094225.1 INPP5B_PH 6..150 CDD:293381
INPP5c_INPP5B 268..561 CDD:197327 108/331 (33%)
RhoGAP_OCRL1 695..915 CDD:239845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1399831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.