DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and FIG4

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_608841.1 Gene:FIG4 / 33658 FlyBaseID:FBgn0031611 Length:858 Species:Drosophila melanogaster


Alignment Length:423 Identity:87/423 - (20%)
Similarity:145/423 - (34%) Gaps:128/423 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VSFAKCNADTSANHVNNNGSTLKSQTLPLEKSHSGLISFHRRAKPSSSKGKNHSHRHSTDAGSQS 129
            |..||...|:....:..|.......||.|:...|.|:  ||          ..::|.:...||| 
  Fly   479 VKSAKLEFDSDCVTMLENLYEEHGDTLALQYGGSQLV--HR----------IKTYRKTAPWGSQ- 530

  Fly   130 DGGADVVMRRKSPKHRSPNHNRFS-----HQFSLCCKAEKKPMT---PPVTV------RYNS-IP 179
              |:| ||:..|..:    .|.||     |..:|.....|..:|   ||:..      .:|: :|
  Fly   531 --GSD-VMQTLSRYY----SNTFSDTEKQHSINLFLGIYKPSLTKQGPPIWELQTDYDMHNAFVP 588

  Fly   180 DSNS------VLRRDNLSLSWSMVDNN-----------SG----SLHSSEGSSHRPRPSSECASA 223
            .::|      |..:....|.:|..|:|           ||    ..:|:...|.:....||..:.
  Fly   589 RADSKAITDWVRHKVRACLPYSCADSNKLVKELFRVHSSGLEMIDAYSNYHQSFKWTDFSEHIAF 653

  Fly   224 PESPVASK---TFFAHCSPAAASASVARSESLQNRSPIRPMAVSACRSRLRLKLYPPGQELPPLQ 285
            ..|.:|.:   ||..:.||.......:| ::.||.|.....:..:..|.               .
  Fly   654 EISQLALRYMPTFRTNFSPFQRQIQTSR-KARQNPSMTGQSSTGSMNSN---------------S 702

  Fly   286 AATEPGD------------IKRATTPQHMSSPNIATQPDGIEHIEEQPG--VRFMSHENMTLQRQ 336
            :::..||            .::.......:.|..||...|:..:||..|  :...|.::|.:.::
  Fly   703 SSSSEGDDSSSDEELSASFAEKEANQTESTEPAAATLATGLPSMEEIYGCTINPPSKQSMAVYKK 767

  Fly   337 -------GSGSNLARQTLMA---------AHALNLIPADNARERSYLDGRLGSTSLLGPSELSRV 385
                   .||.....||.:|         ...:.|.|..:....|||..|            ..|
  Fly   768 YVQMGKLSSGGARPAQTAVAQRDQELAKIMRGITLRPLSDYGTDSYLSVR------------PPV 820

  Fly   386 LPQKEITVFV------GTWNMNGHSPPKQLNDF 412
            :|:|.:|::.      .|:|    :.|| |.:|
  Fly   821 VPRKSLTIYAEYCRTRSTFN----AVPK-LEEF 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 9/32 (28%)
FIG4NP_608841.1 COG5329 19..599 CDD:227637 33/139 (24%)
Syja_N 85..407 CDD:280532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.