DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and CG9784

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001259623.1 Gene:CG9784 / 32629 FlyBaseID:FBgn0030761 Length:519 Species:Drosophila melanogaster


Alignment Length:341 Identity:103/341 - (30%)
Similarity:152/341 - (44%) Gaps:65/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 VFVGTWNMNGHSPPK-------QLNDFVLPANVE----HVPDIVVMGTQE--STPDR-----FE- 438
            |:|.|||:....|..       .|.|..:..:.:    |:|||..:|.||  :.|.:     |: 
  Fly    33 VYVVTWNVGSRFPDNISLRHLLGLQDVTVDKDTKETNAHLPDIYALGLQEVNAQPQQQVLGLFKE 97

  Fly   439 --WEVTIQETL-GPSHVLFHATTLGTLHLAVYMRRDLIWYCSVPEDASMSVRTGSAFRTKGAVAI 500
              |....:|.| ...:|......:..|.|::::||..:.:....|........|..:..||||::
  Fly    98 DPWTHKAKELLRNYDYVAVKTEQMQGLLLSMFVRRQHVEHLQDIEAEFTRTGFGGIWGNKGAVSV 162

  Fly   501 SFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNLPNQRHKNKDVTQNFDN--VFWC 563
            .|.|:|..:.||.:|||||...:.||:.|.|:|         |.|..:..|...:.:|:  |||.
  Fly   163 RFTLYGCGLAFVVAHLTAHDHMMDERIEDYKQI---------LENHHYHVKRYREIYDHDYVFWF 218

  Fly   564 GDLNFRL------GEPREKLLEWIQNTKFPLPSHLPHGYMHTDQLTSVLADG-AAFRGFMEANIT 621
            |||||||      .|.||.:.:..|:          ...:..|||..|.... .||:...|....
  Fly   219 GDLNFRLQGSDSSTEVRELVRDESQH----------EALIQRDQLYQVREKSQLAFQVLQERLPA 273

  Fly   622 FPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGVSTPTQPHVQCLLYDS 686
            ||||:|:..|:..:|.   :|.||:||||:|..:.     :.||   ||:....:   || .|.|
  Fly   274 FPPTFKFREGTSEYDL---KRRPAWTDRIMYAVQP-----LNRQ---PGMQLSIE---QC-SYKS 323

  Fly   687 VPSITTSDHKPVWALF 702
            .|..|.||||||.:.|
  Fly   324 HPLYTISDHKPVTSDF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 103/341 (30%)
CG9784NP_001259623.1 INPP5c_INPP5J-like 31..341 CDD:197328 103/341 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447408
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.