DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and Sh2d1a

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001300617.1 Gene:Sh2d1a / 20400 MGIID:1328352 Length:144 Species:Mus musculus


Alignment Length:87 Identity:17/87 - (19%)
Similarity:34/87 - (39%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 HGYMHTDQLTSVLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQ 658
            :|..:.|       :.:.::|::         |.|........:.|.:.||....|.   :|:::
Mouse    54 YGLAYVD-------EASRYQGYI---------YTYRVSQTETGSWSAETAPGVHKRF---FRKVK 99

  Fly   659 GLVIRRQTLVPGVSTPTQPHVQ 680
            .|:...|....|:.||.|..|:
Mouse   100 NLISAFQKPDQGIVTPLQYPVE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 17/87 (20%)
Sh2d1aNP_001300617.1 SH2 2..122 CDD:301589 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.