DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and Sh2d1a

DIOPT Version :10

Sequence 1:NP_648566.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_001300617.1 Gene:Sh2d1a / 20400 MGIID:1328352 Length:144 Species:Mus musculus


Alignment Length:87 Identity:17/87 - (19%)
Similarity:34/87 - (39%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 HGYMHTDQLTSVLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQ 658
            :|..:.|       :.:.::|::         |.|........:.|.:.||....|.   :|:::
Mouse    54 YGLAYVD-------EASRYQGYI---------YTYRVSQTETGSWSAETAPGVHKRF---FRKVK 99

  Fly   659 GLVIRRQTLVPGVSTPTQPHVQ 680
            .|:...|....|:.||.|..|:
Mouse   100 NLISAFQKPDQGIVTPLQYPVE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_648566.1 EEP 387..703 CDD:469791 17/87 (20%)
Sh2d1aNP_001300617.1 SH2 2..122 CDD:472789 17/87 (20%)

Return to query results.
Submit another query.