DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and Inpp5k

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_006532570.1 Gene:Inpp5k / 19062 MGIID:1194899 Length:472 Species:Mus musculus


Alignment Length:365 Identity:100/365 - (27%)
Similarity:155/365 - (42%) Gaps:66/365 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 YLDGRLGSTSLLGPSELSRVLPQK-EITVFVGTWNMNGHSPPKQLNDFVLPANVEHVPDIVVMGT 429
            |.:|.:.:.||..||     .|:. .::|.|.|||:...:|...|:|.:...|.:...||.::|.
Mouse    11 YREGIMSAVSLRRPS-----APKGFALSVHVVTWNVASAAPTVDLSDLLQLNNQDLNLDIYIIGL 70

  Fly   430 QES--------TPDRFE--WEVTIQETLGP-SHVLFHATTLGTLHLAVYMRRDLIWYCSVPEDAS 483
            ||.        :...||  |.....:.|.| :.|......:..|.|.|:.:...:.|..:....|
Mouse    71 QEMNFGIISLLSDAAFEDPWSSLFMDMLSPLNFVKISQVRMQGLLLLVFAKYQHLPYIQIISTKS 135

  Fly   484 MSVRTGSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINAL-----DLPRNL 543
            ........:..||.|.:...|:|..:..:..||..|.....:|:....||:.:|     |:|..|
Mouse   136 TPTGLYGYWGNKGGVNVCLKLYGYYVSIINCHLPPHMYNNDQRLEHFDRILESLTFEGYDVPNIL 200

  Fly   544 PNQRHKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGY----MHTDQLTS 604
                        :.|.:.|.||:|||:   .:..|.::|.:       :...|    ...|||..
Mouse   201 ------------DHDLILWFGDMNFRI---EDFGLLFVQES-------ITRKYYKELWEKDQLFI 243

  Fly   605 VLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVP 669
            ...:....|.|.|..:.||||||:|..|.|:|||.|:|.||:|||||::        ::||   |
Mouse   244 AKKNDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRKPAWTDRILWR--------LKRQ---P 297

  Fly   670 GVSTP---TQPHVQCLL----YDSVPSITTSDHKPVWALF 702
            ..::|   :.|....||    |.|..:.:.||||||...|
Mouse   298 SQASPLASSVPTSYFLLTLKNYVSHMAYSISDHKPVTGTF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 94/344 (27%)
Inpp5kXP_006532570.1 EEP 32..339 CDD:382041 93/339 (27%)
SKICH 350..454 CDD:375315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.