powered by:
Protein Alignment INPP5E and SH2D1B
DIOPT Version :9
Sequence 1: | NP_001261753.1 |
Gene: | INPP5E / 39404 |
FlyBaseID: | FBgn0036273 |
Length: | 747 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_444512.2 |
Gene: | SH2D1B / 117157 |
HGNCID: | 30416 |
Length: | 132 |
Species: | Homo sapiens |
Alignment Length: | 48 |
Identity: | 12/48 - (25%) |
Similarity: | 19/48 - (39%) |
Gaps: | 3/48 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 RITSSTSSPRSGHKTASSLFGLLSKRPSKVEPH---PVTPESPRLQQR 55
||.::..||:....:...|.....|....:..| |:...||.|:.|
Human 64 RIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWR 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
INPP5E | NP_001261753.1 |
EEP |
387..703 |
CDD:321002 |
|
SH2D1B | NP_444512.2 |
SH2_SAP1 |
1..103 |
CDD:198205 |
8/38 (21%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5411 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.