DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and synj1

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_004912203.1 Gene:synj1 / 100487517 XenbaseID:XB-GENE-956330 Length:1548 Species:Xenopus tropicalis


Alignment Length:421 Identity:132/421 - (31%)
Similarity:185/421 - (43%) Gaps:92/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 ARQTLMAAHALNLIPADNARERSYLDGRLGSTSLLGPSELSRVL------------PQKEITVFV 395
            |...|:..:.||...||.|| .....|.|..:.|:..|...|||            |:| |.:.|
 Frog   479 AIDVLLLGNTLNSDLADKAR-ALLTTGSLHVSELMLQSASPRVLRCMCENYYRYAKPRK-IRICV 541

  Fly   396 GTWNMNGHSPPKQ----------LNDFVLP----ANVEHVP-------DIVVMGTQE-------- 431
            ||||:||   .||          |.|::|.    |.::...       ||..:|.:|        
 Frog   542 GTWNVNG---GKQFRSIAYKNSTLTDWLLDAPRIAGIQEFQDRRSKPVDIFAIGFEEMVELNAGN 603

  Fly   432 ----STPDRFEWEVTIQETLGPSH--VLFHATTLGTLHLAVYMR-------RDLIWYCSVPEDAS 483
                ||.::..|...:|:|:...|  ||..:..|..:.|.:::|       ||:         |.
 Frog   604 IVNASTANQKLWATELQKTVSRDHKYVLLASEQLVGVCLYIFIRPQHAPFIRDV---------AV 659

  Fly   484 MSVRT--GSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNLPNQ 546
            .:|:|  |.|...||||||......||:.||.||..|.|.:||||..|...|...|..|......
 Frog   660 DTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDYNEIARKLSFPMGRMLF 724

  Fly   547 RHKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGYMHTDQLTSVLADGAA 611
            .|         |.||||||.|:|:..|.|::.|.|:|..:       ...:..|||.:....|..
 Frog   725 SH---------DYVFWCGDFNYRIDLPNEEVKEMIRNQNW-------DSLILGDQLINQKNSGQV 773

  Fly   612 FRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQ------MQGLVIRRQTLVPG 670
            ||||.|..|.|.||||||..|.::|||.|.|.||:|||:|::.|:      .:.|.:...:|..|
 Frog   774 FRGFQEGKINFAPTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNSSLQEG 838

  Fly   671 VSTPTQPHVQCLLYDSVPSITTSDHKPVWAL 701
            .:.|...:...||:.....:.||||:|:.:|
 Frog   839 KNIPYTWNPGTLLHYGRVELKTSDHRPIVSL 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 117/365 (32%)
synj1XP_004912203.1 COG5329 9..484 CDD:227637 1/4 (25%)
EEP 537..872 CDD:382041 115/361 (32%)
RRM_SF 871..987 CDD:388407
PHA03247 <1061..1264 CDD:223021
PHA03378 <1072..1483 CDD:223065
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.