DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and sh2d1ab

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_001920648.3 Gene:sh2d1ab / 100148259 ZFINID:ZDB-GENE-091204-326 Length:108 Species:Danio rerio


Alignment Length:72 Identity:15/72 - (20%)
Similarity:30/72 - (41%) Gaps:19/72 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 RGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGVSTPTQP 677
            :||:         |.|.....:..:.:.:.||..|.|:   :|:::.|:...:....|::.|   
Zfish    48 KGFV---------YTYRLQKDSAGSWAAETAPGQTKRL---FRKVKNLISAFEKPGQGIAIP--- 97

  Fly   678 HVQCLLY 684
                |||
Zfish    98 ----LLY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 15/72 (21%)
sh2d1abXP_001920648.3 SH2_SAP1a 2..103 CDD:198263 15/72 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5411
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.