DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INPP5E and inpp5ka

DIOPT Version :9

Sequence 1:NP_001261753.1 Gene:INPP5E / 39404 FlyBaseID:FBgn0036273 Length:747 Species:Drosophila melanogaster
Sequence 2:XP_009290059.1 Gene:inpp5ka / 100037338 ZFINID:ZDB-GENE-070410-101 Length:546 Species:Danio rerio


Alignment Length:446 Identity:122/446 - (27%)
Similarity:182/446 - (40%) Gaps:84/446 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 LQRQGSG--------SNLARQTLMAAHALNLIPADNARERSYLDGRLGST---SLLGPSELSRVL 386
            ||||.|.        |..:||.:....|:.|...|:......|..::..|   :.|...:::...
Zfish    16 LQRQRSDSAASSSTQSTSSRQHVRQRLAMLLTCVDDLDTDHKLQTQVAKTLDEAFLVCRQIAGRP 80

  Fly   387 PQKEITVFVGTWNMNGHSPPKQLNDFVLPANVEHVPDIVVMGTQE--STPDRF--------EWEV 441
            .:....::|.|||:....||..:| .:|..|....||:.|:|.||  :.|.:|        .|..
Zfish    81 KKNPFRLYVVTWNVATAEPPDDVN-ALLQLNSPKKPDLYVIGLQEVRAAPLKFVSDLAFEDSWSH 144

  Fly   442 TIQETLGPSHVLFHATTLGTLHLAVYMRRDLIWYCS----VPEDASMSV---RTG--SAFRTKGA 497
            ...:||.|.|.:..:        ::.|:..|:.:.|    ||....:.|   |||  ..:..||.
Zfish   145 LFMDTLSPLHYIKVS--------SIRMQGLLLLFFSKLEHVPFIRDIQVTYTRTGLYGYWGNKGG 201

  Fly   498 VAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLPRNLPNQRHKNKDVTQNFDN--V 560
            |.|....:|..:.|:..|||||.....:||.:.:.|::|         |....|:.....|:  |
Zfish   202 VTIRLSFYGHMLCFLNCHLTAHMNYASQRVDEFEHILDA---------QNFNTKNTPHVLDHKVV 257

  Fly   561 FWCGDLNFRLGEPREKLL--EWIQNTKFPL--PSHLPHGYMHTDQLTSVLADGAAFRGFMEANIT 621
            ||.||||||: |....|.  ..|.:.:|.|  |.         ||||.:.......:.|.|..:.
Zfish   258 FWFGDLNFRI-EDHGMLFVRNCITSQRFNLLWPK---------DQLTMMKQKEVILQKFEEGPLD 312

  Fly   622 FPPTYKYDPGSQNFDT---------SSKQRAPAYTDRILYKYRQMQGLVIRRQTLVPGVSTPTQP 677
            |.||||:|..|.|:||         :.|:|.||:.||||::.:....|........|......:.
Zfish   313 FQPTYKFDLNSDNYDTRVQTTWFGFNGKKRKPAWCDRILWRVKPKASLTENTNEEEPEKQQEEER 377

  Fly   678 HVQCLL------YDSVPSITTSDHKPVWALFRTLIRAGTDAIPL----AAGLFSRD 723
            ..:..|      |.|......||||||..:||..:|...:. ||    |.|.:|.|
Zfish   378 EDEFPLKMTQEYYTSKMEYGISDHKPVIGIFRLELRKMYET-PLVQVFAEGEWSAD 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INPP5ENP_001261753.1 EEP 387..703 CDD:321002 99/355 (28%)
inpp5kaXP_009290059.1 INPP5c_INPP5J-like 85..410 CDD:197328 100/352 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.