DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and speE

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_414663.1 Gene:speE / 947726 ECOCYCID:EG10963 Length:288 Species:Escherichia coli


Alignment Length:244 Identity:65/244 - (26%)
Similarity:114/244 - (46%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 YDIDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-LIYTE-----TLMCRGVENYEGK 197
            :.:|.|::..::..|.:.|..:...|.::.||.:....|.| .||.|     .|:..|    ..|
E. coli    19 FAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHG----HAK 79

  Fly   198 EICILGGGDGALLYELLK-ENPKHVVMLEIDELVMQTCNKYL-NVICGDVLEKRKGDQYEIIVGD 260
            .:.|:||||||:|.|:.: :|.:.:.|:|||..|:..|.:|| |...|...:.|    :::::.|
E. coli    80 HVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQYLPNHNAGSYDDPR----FKLVIDD 140

  Fly   261 CVEYLKKFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSFKVLKPDGKYLTHGNGSTC 325
            .|.::.:   ..:.||.:..|.|| ||  .| ||:. |....:|...:.|.|.|.::.. || .|
E. coli   141 GVNFVNQ---TSQTFDVIISDCTD-PI--GP-GESL-FTSAFYEGCKRCLNPGGIFVAQ-NG-VC 195

  Fly   326 KVQLRLFEEQLNLLRPKVKFTTTKAFVPSFMEEWLFYQVTFAXQAQVDS 374
            .:|.   ||.::..|....:.:...|..:.:..:....:||| ....|:
E. coli   196 FLQQ---EEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDNDA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 61/230 (27%)
speENP_414663.1 PRK00811 7..284 CDD:234843 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.