DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and SPE4

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_013247.1 Gene:SPE4 / 850838 SGDID:S000004136 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:80/328 - (24%)
Similarity:134/328 - (40%) Gaps:71/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PPIKRGGYIDIYMTSSDERIIEYDIDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-L 180
            |.||.|.:.:|...|...:.....:|.:::||||.||.|.|..:|..|.:|:||.:....|.| .
Yeast     8 PYIKDGWFREINDKSFPGQAFTMTVDSILYEARSEFQDILIFRNKVYGTVLVLDGIVQCTEFDEF 72

  Fly   181 IYTETLMCRGVENYEG-KEICILGGGDGALLYELLKEN-PKHVVMLEIDELVMQTCNKYLNVICG 243
            .|.|.:....:..:.. |.:.|:|||||.:|.|:.|.: .:.:.|:|||..|::...|:|..:..
Yeast    73 AYQEMITHIAMFAHSNPKRVLIIGGGDGGVLREVAKHSCVEDITMVEIDSSVIELSRKFLPTLSN 137

  Fly   244 DVLEKRKGDQYEIIVGDCVEYLKKFIAEG--RKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHS 306
            ...:   .::.::.:.|..::|:...|..  :|||.:..|.:|      |||....|.:   |..
Yeast   138 GAFD---DERLDLKLCDGFKFLQDIGASDVHKKFDVIITDSSD------PEGPAEAFFQ---ERY 190

  Fly   307 FKVLK----PDG--------------KYLTHGNGSTCKVQLRLFEEQLNLLRPKVKFTTTKAFVP 353
            |::||    |:|              ||| |...:|.|   ::|        |..::..|  .||
Yeast   191 FELLKDALNPNGVVIMQSSENFWLNLKYL-HDLKNTAK---KVF--------PNTEYCYT--MVP 241

  Fly   354 SFMEEWLFYQVTFAXQAQVDSSAAAVATSSAPPTASHTPASHSISQEPGTVGEMLQLHSYTVTIH 418
            ::                .......:..|:......:.|......||.|      :|..|...||
Yeast   242 TY----------------TSGQLGLIVCSNNANIPLNIPQRKISEQEQG------KLKYYNPQIH 284

  Fly   419 GAA 421
            .:|
Yeast   285 SSA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 64/247 (26%)
SPE4NP_013247.1 speE 14..293 CDD:188048 76/322 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.