DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sms and SPDS1

DIOPT Version :9

Sequence 1:NP_001287045.1 Gene:Sms / 39403 FlyBaseID:FBgn0036272 Length:458 Species:Drosophila melanogaster
Sequence 2:NP_173794.3 Gene:SPDS1 / 838993 AraportID:AT1G23820 Length:334 Species:Arabidopsis thaliana


Alignment Length:291 Identity:73/291 - (25%)
Similarity:130/291 - (44%) Gaps:46/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 IDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-LIYTETL----MCRGVENYEGKEIC 200
            ::||:|:.:|.:|.:.:..|.|.|.:|:||.:..:.|.| ..|.|.:    :| .:.|  .|::.
plant    64 VEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAYQEMITHLPLC-SIPN--PKKVL 125

  Fly   201 ILGGGDGALLYELLKE-NPKHVVMLEIDELVMQTCNKYLNVICGDVLEKRKGDQYEIIVGDCVEY 264
            ::|||||.:|.|:.:. :.:.:.|.|||::|:....::.    .||....:..:..:::||.|.:
plant   126 VIGGGDGGVLREVARHASIEQIDMCEIDKMVVDVSKQFF----PDVAIGYEDPRVNLVIGDGVAF 186

  Fly   265 LKKFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSFKVLKPDGKYLTHGNGSTCKVQL 329
            ||. .||| .:|.|..|.:| ||..|.|    .|.:..|:...:.|:|.|...|  ...:..:.:
plant   187 LKN-AAEG-SYDAVIVDSSD-PIGPAKE----LFEKPFFQSVARALRPGGVVCT--QAESLWLHM 242

  Fly   330 RLFEEQLNLLRPKVKFTTTKAF--VPSFMEEWLFYQVTFAXQAQVDSSAAAVATSSAPPTASH-- 390
            .:.|:.::..|...|.:...|:  ||::....:.:.:... ...||              ..|  
plant   243 DIIEDIVSNCREIFKGSVNYAWTSVPTYPSGVIGFMLCSTEGPDVD--------------FKHPL 293

  Fly   391 TPASHSISQEPGTVGEMLQLHSYTVTIHGAA 421
            .|...|.|:..|      .|..|...||.||
plant   294 NPIDESSSKSNG------PLKFYNAEIHSAA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmsNP_001287045.1 AdoMet_MTases 137..362 CDD:302624 60/228 (26%)
SPDS1NP_173794.3 PLN02366 30..334 CDD:215208 73/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.